PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00145.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 328aa    MW: 36926.4 Da    PI: 6.1914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00145.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++lv +v+++G g W+t +++ g++R++k+c++rw +yl
  Rsa1.0_00145.1_g00012.1 15 KGAWTPEEDQKLVSYVNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                             79********************************************97 PP

2Myb_DNA-binding54.13.6e-1768112147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +T++E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
  Rsa1.0_00145.1_g00012.1  68 RGEFTEDEERSIISLHALHGNK-WAAIARGLP-GRTDNEIKNHWNTH 112
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7781062IPR017930Myb domain
SuperFamilySSF466897.49E-3012109IPR009057Homeodomain-like
SMARTSM007172.7E-131464IPR001005SANT/Myb domain
PfamPF002491.3E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-241669IPR009057Homeodomain-like
CDDcd001676.54E-101762No hitNo description
PROSITE profilePS5129426.23263117IPR017930Myb domain
SMARTSM007172.3E-1667115IPR001005SANT/Myb domain
PfamPF002499.2E-1668112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2570118IPR009057Homeodomain-like
CDDcd001677.66E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLVSYV NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEERSII SLHALHGNKW AAIARGLPGR TDNEIKNHWN THIKKRLIKK  120
GVDPVTHKSV NLPEIPEKQN VIPTIITSDV DLDNEKMKNN NKKPGLSSAK FLNRVANRFG  180
KRINQSVLSD IIGSGGPVTT ITTSHTAATT TSVTVNSESD KSTSSSFTPA SSLPCQMTVN  240
GNATSSPSTF SDASVNDHLM HCDNEDNIEF SRFLNDEDFM MFEESCVDNT EFMKELTRFL  300
EEDVNDDLEV MPVYEHQEKF EEIDNYFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842970.0FJ584297.1 Brassica rapa subsp. pekinensis MYB domain protein 51-2 gene, complete cds.
GenBankKJ6701190.0KJ670119.1 Brassica napus MYB transcription factor 51 (MYB51.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657262.10.0PREDICTED: transcription factor MYB51-like
SwissprotO497821e-157MYB51_ARATH; Transcription factor MYB51
TrEMBLA0A078E3Z80.0A0A078E3Z8_BRANA; BnaA08g22580D protein
TrEMBLC5HYG90.0C5HYG9_BRARP; MYB domain protein 51-2
STRINGBra016553.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-150myb domain protein 51